# Aptamer Name Aptamer Target (General) Aptamer Target (Specific) Length Affinity Buffer GC Content Sequence Reference
241 CD59 (sp22) Protein CD59 22 N/A nM  Washed with cold PBS and glycine buffer added. Chilled on ice for 15 minutes. 5'-ACHWPWCHGWHSACDLPMHPMC-3' Li et al. "Identification of a novel short peptide seal specific to CD59 and its effect on HeLa cell growth and apoptosis." Cell Oncol. 35:355-365.
242 GHS-R binding peptide (G5-1) Protein growth hormone secretagogue receptor 28 2.40 nM 10mM Hepes-Na-OH, pH 7.4: 135 mM NaCl, 5 mM KCl, 2.5 mM CaCl2, 0.8 mM MgCl2, 10 mM glucose, 0.2% BSA, and 0.6 mM NaHCO3. 4 °C. 5'-FQFLPFMFHQRVQQRKESKKPPAKLQPR-3' S Ueno et al. In vitro selection of a peptide antagonist of growth hormone secretagogue receptor using cDNA display. PNAS, posted on June 20, 2012, doi: 10.1073/pnas.1203561109
243 HIV co-receptor CCR5 (BY6M4)  Protein CCR5 44 N/A nM RPMI-10 medium 5'-MAYPYDVPDYADLPNLWFIIIFLRLVVLFLLFVIVLIRASVLYW-3' Scheideman EH, DiMaio D, et al. (2012) Transmembrane protein aptamers that inhibit CCR5 expression and HIV coreceptor function. J. Virol. 86: 10281-10292.
244 Anti-human platelet antigen antibodies (Trx-HPA-1a) Protein Anti-human platelet antigen antibodies (HPA-1a) 133 N/A nM Buffer for ELISA assay: PBS. 5'-MMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPVVAGDDPREDTWGPCKMIAPILDEIADEYQGKLTVAKLNIAQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLVDLQHHHHHH-3 J Thibaut et al. A novel assay for the detection of anti-human platelet antigen antibodies (HPA-1a) based on peptide aptamer technology. haematologica 97(2012): 696-704.
245 Apt 14 RNA vascular smooth muscle cell (VSMC) 92 ± 2 nM 5?-TCGGGCGAGTCGTCTGGGGAGGTCAGAACGAAAGGCCCGCATCGTCCTCCC-3? https://www.sciencedirect.com/science/article/pii/S1525001616310012?via%3Dihub
246 threose nucleic acid (TNA) aptamer ochratoxin A (OTA) GCCGAGATTGCACTTACTATCTCAATAGGGTAAAAAAAAAAAGTTGGTCCTATGGGTGGGTTGTTCAGTAATTGAATAAGCTGGTATGCGC ® https://academic.oup.com/nar/article/46/16/8057/5061972
247 RhB-?F02 Nucleic acid rhodamine B 82 20.89 ±> 2.37 nM The nucleic acid aptamer is screened out with SELEX technol 5’-GCTAGACGATATTCGTCCATCTCCCGTGCATCCGAGACCGTGAGTTGGACTGACCCGCTTCCGCTGTCAGACTGAATATGTC-3’ https://patents.google.com/patent/CN108486119A/en?q=Nucleic+acid&q=aptamer+RhB-%E2%80%8BF02&oq=Nucleic+acid+aptamer+RhB-%E2%80%8BF02+
248  EpDT3 aptamer RNA  EpCAM https://patents.google.com/patent/CN108403665A/en?q=EpDT3&q=aptamer&oq=+EpDT3+aptamer
249 Oligonucleotide aptamer
250 RCAN1-?s14 aptamer  RCAN1 protein gel electrophoresis buffer is added to streptavidin-beads, 95 ° C denaturation for 5 min RCANl.ls-l-103aa-6myc levels by Western blotting and detection of anti-myc antibody 9E10. 20.83 5’-AUACAACAAAAACAAAAACAAGAAA-3’ https://patents.google.com/patent/CN108384787A/en?q=RCAN1-%E2%80%8Bs14&oq=RCAN1-%E2%80%8Bs14